PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Migut.B01552.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
Family HD-ZIP
Protein Properties Length: 307aa    MW: 33944.9 Da    PI: 7.3733
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Migut.B01552.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-18143197256
                       T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
          Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                       rk+ +++keq  +Lee F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Migut.B01552.1.p 143 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKQLNLRARQVEVWFQNRRARTK 197
                       788899***********************************************98 PP

2HD-ZIP_I/II125.13.2e-40143232191
       HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                       +kk+rlskeq+++LEe+F+e+++L+p++K++la++L+l++rqv+vWFqnrRARtk+kq+E+d+e+L+r++++l++en+rL+kev+eLr +l
  Migut.B01552.1.p 143 RKKLRLSKEQAAVLEETFKEHNTLNPKQKMALAKQLNLRARQVEVWFQNRRARTKLKQTEVDCEYLRRCCENLTDENRRLQKEVTELR-AL 232
                       69*************************************************************************************9.55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046182.6E-261121IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.4E-18116200IPR009057Homeodomain-like
SuperFamilySSF466892.78E-18134200IPR009057Homeodomain-like
PROSITE profilePS5007117.184139199IPR001356Homeobox domain
SMARTSM003891.0E-14141203IPR001356Homeobox domain
PfamPF000464.6E-16143197IPR001356Homeobox domain
CDDcd000861.46E-14143200No hitNo description
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
SMARTSM003404.6E-26199242IPR003106Leucine zipper, homeobox-associated
PfamPF021839.5E-11199233IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MAEKDDGLGL SLSLGCPDNN QIQNHHPSPA ATPPPPPTAA TRFPLNFFRS PLPFMQQHVS  60
SSSDAFHPSS TDRNAEARSS LFRGIDMNIR AVSVIDCDEE VMVSSPNSTV SSLSGKRSER  120
EDNDGESLDL DDDGGDGGDA AARKKLRLSK EQAAVLEETF KEHNTLNPKQ KMALAKQLNL  180
RARQVEVWFQ NRRARTKLKQ TEVDCEYLRR CCENLTDENR RLQKEVTELR ALKLSPQFYM  240
NMSPPTTLTM CPQCERVAVS SSSSSAASAS LDRPTTNGST HHHHHRPVPM NSWAAVIPPH  300
HHRTGS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012843531.10.0PREDICTED: homeobox-leucine zipper protein HAT4-like
SwissprotP466021e-88HAT3_ARATH; Homeobox-leucine zipper protein HAT3
TrEMBLA0A022QZE61e-141A0A022QZE6_ERYGU; Uncharacterized protein (Fragment)
STRINGSolyc01g090460.2.11e-109(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA11182485
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.13e-76homeobox protein 2